PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca23361.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family TALE
Protein Properties Length: 142aa    MW: 16828 Da    PI: 9.495
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca23361.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox25.32.7e-08911242154
                 HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 k +yp+++++++L +++gL+ +q+ +WF N+R +
  Dca23361.1  91 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 124
                 469*****************************87 PP

2ELK21.74.9e-084566122
         ELK  1 ELKhqLlrKYsgyLgsLkqEFs 22
                ELK +L++++++++ ++++E++
  Dca23361.1 45 ELKLELKQGFKSKIEDVREEIL 66
                9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512139.1144565IPR005539ELK domain
PROSITE profilePS5007111.62965128IPR001356Homeobox domain
SuperFamilySSF466898.98E-1767133IPR009057Homeodomain-like
SMARTSM003893.1E-1167132IPR001356Homeobox domain
CDDcd000869.84E-1168129No hitNo description
Gene3DG3DSA:1.10.10.603.7E-2672130IPR009057Homeodomain-like
PfamPF059203.0E-1885124IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 142 aa     Download sequence    Send to blast
MSDDEDDLQL DYPMDQSGAD VNDMMMGFGL PTESERSLME RVRHELKLEL KQGFKSKIED  60
VREEILRKRR AGKLPGDTTS VLKAWWQQHS KWPYPTEDDK AKLVEETGLQ LKQINNWFIN  120
QRKRNWHNNS HTSNSLKSKR KR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A3e-1468124864Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1121141RKRNWHNNSHTSNSLKSKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010676578.11e-87PREDICTED: homeobox protein HD1
SwissprotP466067e-83HD1_BRANA; Homeobox protein HD1
TrEMBLA0A0K9RVV32e-88A0A0K9RVV3_SPIOL; Uncharacterized protein
STRINGGLYMA11G02960.12e-85(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.13e-83KNOTTED-like homeobox of Arabidopsis thaliana 7